PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_134230_aref.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 240aa    MW: 26691.8 Da    PI: 9.8933
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_134230_aref.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.98.1e-17170218452
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                         ++r +r++kNRe+A rsR+RK+a+i eLe +v +L++eN +L+k+  + 
  Bv6_134230_aref.t1 170 DRRFKRMIKNRESAARSRARKQAYISELELEVVQLTKENAMLRKQQRQF 218
                         6899***************************************987664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-14167231IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76169221IPR004827Basic-leucine zipper domain
PfamPF001706.2E-15171221IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.1E-15171223No hitNo description
CDDcd147071.33E-24171225No hitNo description
SuperFamilySSF579593.31E-12171222No hitNo description
PROSITE patternPS000360174189IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MTSTESRSLS SSSSSSPSPS PFSPCFSLHQ PNKTMEEVWK DITMNSLPNT PIPHIHTIHH  60
PTPTSHFKGM ILQDFLNASG AGDSRINSIR SSSSSSSPLY SPPPPPPPPP PTEFQFFDSE  120
RFQIQRNSPV SNFIAFDNSL AASFGVAADD VVTGINKKRF CQGDEDASGD RRFKRMIKNR  180
ESAARSRARK QAYISELELE VVQLTKENAM LRKQQRQFIE ETSAQLPKKH GLHRTSTASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010680407.11e-176PREDICTED: protein FD-like isoform X1
TrEMBLA0A0J8CBH21e-176A0A0J8CBH2_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.12e-27bZIP family protein